Primary amines
- (22)
- (140)
- (10)
- (8)
- (4)
- (29)
- (1)
- (4)
- (3)
- (1)
- (72)
- (35)
- (8)
- (2)
- (5)
- (1)
- (1)
- (2)
- (1)
- (1)
- (14)
- (4)
- (1)
- (3)
- (169)
- (57)
- (4)
- (13)
- (17)
- (20)
- (1)
- (6)
- (1)
- (1)
- (1)
- (4)
- (1)
- (181)
- (4)
- (28)
- (15)
- (5)
- (2)
- (41)
- (49)
- (2)
- (1)
- (4)
- (14)
- (3)
- (8)
- (4)
- (4)
- (5)
- (4)
- (1)
- (2)
- (2)
- (1)
- (2)
- (2)
- (2)
- (1)
- (5)
- (1)
- (2)
- (4)
- (1)
- (1)
- (24)
- (2)
- (3)
- (4)
- (7)
- (6)
- (2)
- (3)
- (6)
- (7)
- (13)
- (4)
- (2)
- (2)
- (5)
- (13)
- (4)
- (7)
- (14)
- (4)
- (1)
- (1)
- (6)
- (1)
- (2)
- (10)
- (1)
- (4)
- (5)
- (2)
- (5)
- (2)
- (3)
- (2)
- (9)
- (1)
- (3)
- (4)
- (2)
- (2)
- (2)
- (1)
- (9)
- (1)
- (1)
- (3)
- (4)
- (9)
- (4)
- (6)
- (1)
- (2)
- (5)
- (2)
- (2)
- (2)
- (9)
- (5)
- (3)
- (5)
- (2)
- (2)
- (2)
- (6)
- (1)
- (1)
- (3)
- (3)
- (5)
- (1)
- (5)
- (3)
- (4)
- (2)
- (2)
- (3)
- (5)
- (8)
- (3)
- (1)
- (1)
- (2)
- (3)
- (7)
- (5)
- (2)
- (3)
- (3)
- (2)
- (3)
- (2)
- (2)
- (8)
- (3)
- (2)
- (3)
- (3)
- (8)
- (1)
- (1)
- (1)
- (6)
- (3)
- (8)
- (2)
- (2)
- (19)
- (4)
- (2)
- (9)
- (8)
- (1)
- (1)
- (1)
- (5)
- (6)
- (2)
- (1)
- (5)
- (11)
- (1)
- (2)
- (1)
- (1)
- (2)
- (2)
- (3)
- (11)
- (1)
- (9)
- (2)
- (1)
- (2)
- (6)
- (2)
- (2)
- (4)
- (1)
- (1)
- (1)
- (2)
- (9)
- (2)
- (1)
- (2)
- (1)
- (1)
- (2)
- (1)
- (2)
- (1)
- (1)
- (1)
- (3)
- (2)
- (3)
- (7)
- (1)
- (1)
- (2)
- (1)
- (1)
- (2)
- (1)
- (1)
- (5)
- (1)
- (2)
- (3)
- (2)
- (2)
- (2)
- (1)
- (2)
- (2)
- (1)
- (2)
- (1)
- (6)
- (4)
- (5)
- (1)
- (2)
- (1)
- (2)
- (9)
- (5)
- (16)
- (9)
- (2)
- (8)
- (17)
- (7)
- (5)
- (8)
- (10)
- (10)
- (24)
- (20)
- (2)
- (1)
- (5)
- (8)
- (7)
- (2)
- (1)
- (12)
- (6)
- (6)
- (21)
- (11)
- (7)
- (11)
- (8)
- (4)
- (3)
- (3)
- (8)
- (1)
- (2)
- (4)
- (1)
- (2)
- (2)
- (12)
- (3)
- (3)
- (5)
- (2)
- (7)
- (4)
- (15)
- (2)
- (3)
- (8)
- (6)
- (3)
- (45)
- (2)
- (40)
- (118)
- (2)
- (7)
- (9)
- (6)
- (18)
- (40)
- (4)
- (14)
- (1)
- (6)
- (13)
- (6)
- (11)
- (2)
- (2)
- (3)
- (4)
- (5)
- (3)
- (2)
- (1)
- (1)
- (13)
- (2)
- (18)
- (8)
- (76)
- (1)
- (161)
- (10)
- (5)
- (144)
- (29)
- (4)
- (2)
- (2)
- (8)
- (15)
- (177)
- (3)
- (5)
- (1)
- (4)
- (3)
- (4)
- (2)
- (3)
- (331)
- (3)
- (4)
- (6)
- (4)
- (2)
- (27)
- (5)
- (4)
- (4)
- (3)
- (2)
- (2)
- (3)
- (4)
- (5)
- (3)
- (3)
- (3)
- (3)
- (3)
- (6)
- (2)
- (2)
- (1)
- (2)
- (1)
- (2)
- (5)
- (2)
- (3)
- (7)
- (13)
- (2)
- (3)
- (2)
- (2)
- (3)
- (2)
- (1)
- (3)
- (6)
- (2)
- (1)
- (2)
- (2)
- (3)
- (4)
- (2)
- (1)
- (3)
- (2)
- (3)
- (1)
- (2)
- (2)
- (8)
- (1)
- (1)
- (2)
- (5)
- (5)
- (2)
- (3)
- (1)
- (2)
- (5)
- (1)
- (1)
- (2)
- (2)
- (2)
- (3)
- (2)
- (3)
- (2)
- (2)
- (2)
- (3)
- (1)
- (4)
- (2)
- (2)
- (2)
- (2)
- (2)
- (2)
- (1)
- (3)
- (1)
- (3)
- (3)
- (2)
- (4)
- (1)
- (2)
- (3)
- (2)
- (2)
- (2)
- (1)
- (4)
- (3)
- (2)
- (2)
- (3)
- (1)
- (3)
- (1)
- (4)
- (2)
- (2)
- (6)
- (4)
- (7)
- (3)
- (3)
- (2)
- (2)
- (5)
- (4)
- (2)
- (7)
- (1)
- (3)
- (3)
- (3)
- (2)
- (1)
- (2)
- (6)
- (2)
- (4)
- (1)
- (4)
- (2)
- (3)
- (3)
- (3)
- (2)
- (3)
- (2)
- (1)
- (3)
- (2)
- (1)
- (3)
- (3)
- (2)
- (1)
- (2)
- (2)
- (1)
- (3)
- (2)
- (5)
- (2)
- (2)
- (1)
- (5)
- (4)
- (2)
- (4)
- (2)
- (3)
- (2)
- (4)
- (3)
- (2)
- (6)
- (2)
- (1)
- (4)
- (6)
- (3)
- (2)
- (7)
- (2)
- (2)
- (3)
- (2)
- (2)
- (4)
- (10)
- (2)
- (1)
- (5)
- (5)
- (2)
- (1)
- (1)
- (2)
- (4)
- (4)
- (2)
- (2)
- (2)
- (4)
- (3)
- (2)
- (2)
- (2)
- (5)
- (4)
- (5)
- (4)
- (3)
- (2)
- (2)
- (2)
- (3)
- (3)
- (1)
- (3)
- (2)
- (2)
- (2)
- (3)
- (2)
- (3)
- (2)
- (2)
- (3)
- (1)
- (2)
- (3)
- (3)
- (1)
- (3)
- (4)
- (1)
- (2)
- (1)
- (1)
- (3)
- (2)
- (2)
- (7)
- (2)
- (1)
Filtered Search Results
Apexbio Technology LLC BIOTIN-ANILINE-10MG
Biotin-aniline (CAS No 769933-15-5) is a compound used in the field of biomedical research primarily within the categories of molecular biology and biochemistry Originating from synthetic processes it functions by targeting cellular pathways through the biotin moiety facilitating the study of protein interactions and post-translational modifications This compound exhibits potent activity within the nanomolar to low micromolar range making it suitable for precise laboratory applications Commonly biotin-aniline is employed in in vitro assays frequently used in various cell models and animal studies It is an effective tool in drug screening processes where it aids in identifying potential therapeutic agents by exploring its interactions with cellular components Experimental concentrations typically depend on the specific research design ensuring flexibility across diverse investigative contexts
Non-distribution item offered as a customer accommodation; additional freight charges may apply.
Learn More
AMBEED 4-2 3-DIFLUOROPHENOXY ANILINE
NC3814723 4-2 3-DIFLUOROPHENOXY ANILINE
Non-distribution item offered as a customer accommodation; additional freight charges may apply.
Learn More
Aobchem 3-(Thiophen-3-yl)aniline hydrochloride | ≥97% | CAS 1240529-35-4 | C10H10ClNS | 1g
3-(Thiophen-3-yl)aniline hydrochloride | ≥97% | CAS 1240529-35-4 | C10H10ClNS | 1g
Non-distribution item offered as a customer accommodation; additional freight charges may apply.
Learn More
Aobchem 4-(Furan-2-yl)aniline hydrochloride | ≥97% | CAS 1170462-44-8 | C10H10ClNO | 1g
4-(Furan-2-yl)aniline hydrochloride | ≥97% | CAS 1170462-44-8 | C10H10ClNO | 1g
Non-distribution item offered as a customer accommodation; additional freight charges may apply.
Learn More
Aobchem 2-(3-Fluorophenoxy)aniline | ≥97% | CAS 640766-67-2 | C12H10FNO | 500mg
2-(3-Fluorophenoxy)aniline | ≥97% | CAS 640766-67-2 | C12H10FNO | 500mg
Non-distribution item offered as a customer accommodation; additional freight charges may apply.
Learn More
Chembridge Corporation 3-(2-FURYL)ANILINE
[3-(2-furyl)phenyl]amine hydrochloride; CAS: 102269-42-1
Non-distribution item offered as a customer accommodation; additional freight charges may apply.
Learn More
![Medchemexpress LLC N-(3-(aminomethyl)benzyl)-8-(4-benzylpiperazin-1-yl)pyrimido[5,4-d]pyrimidin-4-amine | 1875036-75-1 | >98.0% | 25 MG](https://assets.fishersci.com/TFS-Assets/CCG/product-images/5000232153.png-250.jpg)
Medchemexpress LLC N-(3-(aminomethyl)benzyl)-8-(4-benzylpiperazin-1-yl)pyrimido[5,4-d]pyrimidin-4-amine | 1875036-75-1 | >98.0% | 25 MG
Small and Specialty Supplier Partner
Small and/or specialty supplier based on Federal laws and SBA requirements.
Learn More
Small and/or specialty supplier based on Federal laws and SBA requirements.
Learn More
BI-8626 is a small-molecule inhibitor of the HECT E3 ubiquitin ligase HUWE1, identified by high-throughput screening and reported to inhibit HUWE1 with an IC50 of approximately 0.9 μM. It is supplied for research use only and intended for biochemical and cellular studies.
- Specific HUWE1 inhibitor, IC50 ≈ 0.9 μM.
- Used in biochemical and cellular assays to modulate HUWE1-dependent ubiquitination.
- CAS 1875036-75-1; molecular weight 440.54 g·mol⁻¹.
- Typical reported purity ≥98% (HPLC); verify certificate of analysis per lot.
- Available as solid and as 10 mM solution in DMSO for reconstitution.
Non-distribution item offered as a customer accommodation; additional freight charges may apply.
Learn More
eMolecules 400749-02-2 | 3'-Trifluoromethyl-biphenyl-3-ylamine | Combi-Blocks, Inc. | MFCD03424670 | 237.225 | C13H10F3N | 96.000 | Nc1cccc(c1)-c1cccc(c1)C(F)(F)F | 1g | 603150209
3'-Trifluoromethyl-biphenyl-3-ylamine | Combi-Blocks, Inc. | 400749-02-2 | MFCD03424670 | 237.225 | C13H10F3N | 96.000 | Nc1cccc(c1)-c1cccc(c1)C(F)(F)F | 1g | 603150209
Non-distribution item offered as a customer accommodation; additional freight charges may apply.
Learn More
Medchemexpress LLC ICCB-19 (hydrochloride) | 1803605-68-6 | 99.3% | 291.84 | C12H22ClN3OS | 5 MG
Small and Specialty Supplier Partner
Small and/or specialty supplier based on Federal laws and SBA requirements.
Learn More
Small and/or specialty supplier based on Federal laws and SBA requirements.
Learn More
ICCB-19 hydrochloride is a research-grade small molecule that inhibits TRADD-mediated signaling and indirectly inhibits RIPK1 kinase activity. It has been reported to induce autophagy, modulate TNF-induced inflammatory responses, and affect RIPK1-dependent apoptosis in cellular and animal models.
- Targets TRADD and indirectly inhibits RIPK1 kinase activity.
- Binds TRADD N-terminal domain to disrupt protein interactions.
- Promotes autophagy via K63-linked ubiquitination of Beclin-1.
- Reduces TNF-induced inflammatory gene expression in cell and animal studies.
- Provided as a hydrochloride salt with reported high purity.
- Available as solid and DMSO solution aliquots for research use.
Non-distribution item offered as a customer accommodation; additional freight charges may apply.
Learn More
Medchemexpress LLC STIEEQAKTFLDKFNHEAEDLFYQSSLASWN | 95.3% | 3649.88 | 5 MG
Small and Specialty Supplier Partner
Small and/or specialty supplier based on Federal laws and SBA requirements.
Learn More
Small and/or specialty supplier based on Federal laws and SBA requirements.
Learn More
STIEEQAKTFLDKFNHEAEDLFYQSSLASWN | 95.3% | 3649.88 | 5 MG
Non-distribution item offered as a customer accommodation; additional freight charges may apply.
Learn More
eMolecules 1965304-87-3 | 2-(4'-Hydroxy-4-biphenyl)-4,5-diphenylthiazole | Oakwood Chemicals | MFCD28166184 | 405.520 | C27H19NOS | 97.000 | Oc1ccc(cc1)-c1ccc(cc1)-c1nc(c(s1)-c1ccccc1)-c1ccccc1 | 250mg | 480147861
2-(4'-Hydroxy-4-biphenyl)-4,5-diphenylthiazole | Oakwood Chemicals | 1965304-87-3 | MFCD28166184 | 405.520 | C27H19NOS | 97.000 | Oc1ccc(cc1)-c1ccc(cc1)-c1nc(c(s1)-c1ccccc1)-c1ccccc1 | 250mg | 480147861
Non-distribution item offered as a customer accommodation; additional freight charges may apply.
Learn More
Medchemexpress LLC Silydianin | 29782-68-1 | MFCD09970974 | 482.44 | 5 MG
Small and Specialty Supplier Partner
Small and/or specialty supplier based on Federal laws and SBA requirements.
Learn More
Small and/or specialty supplier based on Federal laws and SBA requirements.
Learn More
Silydianin is a flavonolignan obtained from *Silybum marianum*. It inhibits PTP1B, monophenolase, and diphenolase of tyrosinase. Silydianin induces apoptosis and reduces cytokines (IL-4 and IL-5). It also exhibits antitumor activity against prostate cancer. As part of Silymarin, it contributes to antioxidant, cytoprotective, and immunomodulatory effects, and can be used in allergic asthma research.
- Flavonolignan
- Inhibits PTP1B
- Inhibits monophenolase and diphenolase of tyrosinase
- Induces apoptosis and reduces cytokines (IL-4 and IL-5)
- Antioxidant, cytoprotective and immunomodulatory effects
- Antitumor activity against prostate cancer
- Used in allergic asthma research
- Appearance: solid, white to off-white
Non-distribution item offered as a customer accommodation; additional freight charges may apply.
Learn More
Medchemexpress LLC (E)-3-(2-Furyl)acrolein | 39511-08-5 | MFCD00003256 | 97% | 122.12 | 10 G
Small and Specialty Supplier Partner
Small and/or specialty supplier based on Federal laws and SBA requirements.
Learn More
Small and/or specialty supplier based on Federal laws and SBA requirements.
Learn More
(E)-3-(2-Furyl)acrolein, derived from a 2-acid-acid-rich acid reaction, finds applications in various fields including food, cosmetics, medicine, and agriculture. In the food industry, it serves as a natural seasoning food additive with significant flavoring properties. It is also described as a biochemical reagent suitable for life science related research as a biological material or organic compound.
- Used in food, cosmetics, medicine, and agriculture
- Acts as a natural seasoning food additive in the food industry
- Biochemical reagent for life science research
Non-distribution item offered as a customer accommodation; additional freight charges may apply.
Learn More
eMolecules 86217-82-5 | 4-(1-Aminoethyl)biphenyl | Apollo Scientific | MFCD02667819 | 197.281 | C14H15N | 95.000 | CC(N)c1ccc(cc1)-c1ccccc1 | 250mg | 562446561
4-(1-Aminoethyl)biphenyl | Apollo Scientific | 86217-82-5 | MFCD02667819 | 197.281 | C14H15N | 95.000 | CC(N)c1ccc(cc1)-c1ccccc1 | 250mg | 562446561
Non-distribution item offered as a customer accommodation; additional freight charges may apply.
Learn More
eMolecules 62-53-3 | Aniline | Oakwood Chemicals | MFCD00007629 | 93.129 | C6H7N | 99.000 | Nc1ccccc1 | 1kg | 480131721
Aniline | Oakwood Chemicals | 62-53-3 | MFCD00007629 | 93.129 | C6H7N | 99.000 | Nc1ccccc1 | 1kg | 480131721
Non-distribution item offered as a customer accommodation; additional freight charges may apply.
Learn More